HPA004728

TGM3 antibody from Sigma-Aldrich
TGE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004728
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004728, RRID:AB_1080360
Product name
Anti-TGM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004728
Antibody type
Polyclonal
Antigen
Protein-glutamine gamma-glutamyltransferase E precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQ
EPSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKT
VTVNMTAWTIIYNGTLVHEVWKDSATMSLDPEEEA
EHPIKISYAQYEKYLKSDNMI
Storage
-20C
Provider Type Product Number
- No reagents -