PAB23239

UBIAD1 antibody from Abnova Corporation
SCCD, TERE1

Antibody data

Product number
PAB23239
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23239, RRID:AB_11122043
Product name
UBIAD1 polyclonal antibody
Provider product page
Abnova Corporation - PAB23239
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human UBIAD1.
Reactivity
Human
Host
Rabbit
Antigen sequence
YDFSKGIDHKKSDDRTLVDRILEPQDVVRF
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -