Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001046-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001046-M06, RRID:AB_509331
- Product name
- CDX4 monoclonal antibody (M06), clone 3F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDX4.
- Antigen sequence
VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSP
AAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTD
AGAAKASSPSRSRHSPYAWMRKTVQVTGKT- Isotype
- IgG
- Antibody clone number
- 3F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CDX4 monoclonal antibody (M06), clone 3F3. Western Blot analysis of CDX4 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CDX4 monoclonal antibody (M06), clone 3F3. Western Blot analysis of CDX4 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CDX4 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol