HPA008548

AKAP9 antibody from Atlas Antibodies
AKAP350, AKAP450, CG-NAP, HYPERION, KIAA0803, LQT11, MU-RMS-40.16A, PPP1R45, PRKA9, YOTIAO
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008548
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008548, RRID:AB_1078121
Product name
Anti-AKAP9
Provider product page
Atlas Antibodies - HPA008548
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EKLELSQRLSDLSEQLKQKHGEISFLNEEVKSLKQ
EKEQVSLRCRELEIIINHNRAENVQSCDTQVSSLL
DGVVTMTSRGAEGSVSKVNKSFGEESKIMVEDKVS
FENMTVGEESKQEQLILDHLPSVTKESSLRATQPS
ENDKLQKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -