HPA008548

AKAP9 antibody from Sigma-Aldrich
AKAP350, AKAP450, CG-NAP, HYPERION, KIAA0803, LQT11, MU-RMS-40.16A, PPP1R45, PRKA9, YOTIAO
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008548
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008548, RRID:AB_1078121
Product name
Anti-AKAP9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008548
Antibody type
Polyclonal
Antigen
A-kinase anchor protein 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKLELSQRLSDLSEQLKQKHGEISFLNEEVKSLKQ
EKEQVSLRCRELEIIINHNRAENVQSCDTQVSSLL
DGVVTMTSRGAEGSVSKVNKSFGEESKIMVEDKVS
FENMTVGEESKQEQLILDHLPSVTKESSLRATQPS
ENDKLQKE
Storage
-20C
Provider Type Product Number
- No reagents -