HPA020603

IPPK antibody from Atlas Antibodies
C9orf12, FLJ13163, INSP5K2, IP5K, IPK1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020603
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020603, RRID:AB_1851853
Product name
Anti-IPPK
Provider product page
Atlas Antibodies - HPA020603
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEF
PEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFA
LTKVQQYR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -