HPA020603

IPPK antibody from Sigma-Aldrich
C9orf12, FLJ13163, INSP5K2, IP5K, IPK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020603
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020603, RRID:AB_1851853
Product name
Anti-IPPK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020603
Antibody type
Polyclonal
Antigen
Inositol-pentakisphosphate 2-kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEF
PEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFA
LTKVQQYR
Storage
-20C
Provider Type Product Number
- No reagents -