HPA004831

KIF1A antibody from Sigma-Aldrich
ATSV, C2orf20, SPG30, UNC104
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004831
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004831, RRID:AB_1079209
Product name
Anti-KIF1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004831
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKTRHYLLLREKLETAQRPVPEALSPAFSEDSESH
GSSSASSPLSAEGRPSPLEAPNERQRELAVKCLRL
LTHTFNREYTHSHVCVSASESKLSEMSVTLLRDPS
MSPLGVATLTPSSTCPSLV
Storage
-20C
Provider Type Product Number
- No reagents -