WH0022882M1

ZHX2 antibody from MilliporeSigma / Merck KGaA
KIAA0854
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0022882M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0022882M1, RRID:AB_1842205
Product name
Monoclonal Anti-ZHX2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0022882M1
Antibody type
Monoclonal
Antigen
ZHX2 (NP_055758, a.a. 691-789) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MEQYQHQPMADDHGYDAVARKATKPMAESPKNGGD
VVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCL
PAKPSEATSDRSEGSSRDGQGSDENEES* (with
out GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -