HPA006996

ZHX2 antibody from Atlas Antibodies
KIAA0854
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006996
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006996, RRID:AB_10670555
Product name
Anti-ZHX2
Provider product page
Atlas Antibodies - HPA006996
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVK
WMEQYQHQPMADDHGYDAVARKATKPMAESPKNGG
DVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDC
LPAKPSEATSDRSEGSSRDGQGSDENEESSVVDYV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -