Antibody data

Product number
H00022882-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022882-M01, RRID:AB_607300
Product name
ZHX2 monoclonal antibody (M01), clone 5E2
Provider product page
Abnova Corporation - H00022882-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZHX2.
Antigen sequence
MEQYQHQPMADDHGYDAVARKATKPMAESPKNGGD
VVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCL
PAKPSEATSDRSEGSSRDGQGSDENEES
Isotype
IgG
Antibody clone number
5E2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -