AV39156

ZHX2 antibody from MilliporeSigma / Merck KGaA
KIAA0854
No application information provided.

Antibody data

Product number
AV39156
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV39156, RRID:AB_1852345
Product name
Anti-ZHX2 (AB1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV39156
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZHX2 with an internal ID of P21264
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
ASKRKSTTPCMVRTSQVVEQDVPEEVDRAKEKGIG
TPQPDVAKDSWAAEL
Storage
-20C
Provider Type Product Number
- No reagents -