HPA023710

TBC1D31 antibody from Sigma-Aldrich
Gm85, MGC21654, WDR67
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023710
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023710, RRID:AB_1858819
Product name
Anti-WDR67 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023710
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 67 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLLSCNLKDDFEFFFHHRNNLDINVVIRQVYHLME
TTPTDIHPDSMLNVFVALTKGQYPVFNQYPKFIVD
YQTQERERIRNDELDYLRERQTVEDMQAKV
Storage
-20C
Provider Type Product Number
- No reagents -