HPA023013

BICD2 antibody from Sigma-Aldrich
KIAA0699
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023013
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023013, RRID:AB_1845352
Product name
Anti-BICD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023013
Antibody type
Polyclonal
Antigen
Protein bicaudal D homolog 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAE
TTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEA
I
Storage
-20C
Provider Type Product Number
- No reagents -