HPA021421

SPECC1 antibody from Sigma-Aldrich
CYTSB, FLJ36955, HCMOGT-1, NSP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021421
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021421, RRID:AB_1857431
Product name
Anti-CYTSB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021421
Antibody type
Polyclonal
Antigen
Sperm antigen with calponin homology and coiled-coil domains 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTEPMIRALEEKNKNFQKELSDLEEENRVLKEKLI
YLEHSPNSEGAASHTGDSSCPTSITQESSFGSPTG
NQMSSD
Storage
-20C
Provider Type Product Number
- No reagents -