HPA004833

HRC antibody from Sigma-Aldrich
MGC133236
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004833
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004833, RRID:AB_1079083
Product name
Anti-HRC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004833
Antibody type
Polyclonal
Antigen
Sarcoplasmic reticulum histidine-rich calcium-binding protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHEEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVS
GEHHHHVPDHRHQGHRDEEEDEDVSTERWHQGPQH
VHHGLVDEEEEEEEITVQFGHYVASHQPRGHKSDE
EDFQDEYKTEVPHHHHHRVPREEDEEVSAELG
Storage
-20C
Provider Type Product Number
- No reagents -