H00005261-M01A

PHKG2 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00005261-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005261-M01A, RRID:AB_1578704
Product name
PHKG2 monoclonal antibody (M01A), clone 2D12
Provider product page
Abnova Corporation - H00005261-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PHKG2.
Antigen sequence
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVS
SVVRRCVHRATGHEFAVKIMEVTAERLSPEQLEEV
REATRRETHILRQVAGHPHIITLIDSYESSSFMFL
VFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEA
VSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFS
CHLEPGEKLRELCGTPGYLAPEILKCSMDETHPGY
GKEVDLWACGVILFTLLAGSPPFWHRRQILMLRMI
MEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARL
TAEQALQHPFFERCEGSQPWNLTPRQRFRVAVWTV
LAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLI
DNCAFRLYGHWVKKGEQQNRAALFQHRPPGPFPIM
GPEEEGDSAAITEDEAVLVLG
Isotype
IgG
Antibody clone number
2D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -