HPA023708

C8orf76 antibody from Sigma-Aldrich
FLJ14825
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023708
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023708, RRID:AB_1845785
Product name
Anti-C8orf76 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023708
Antibody type
Polyclonal
Antigen
Uncharacterized protein C8orf76 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEK
ALTNIQNCMAEKRETVLIETQLKACASFIRTRLLL
QFTQPQQ
Storage
-20C
Provider Type Product Number
- No reagents -