HPA019711

LANCL2 antibody from Sigma-Aldrich
GPR69B, TASP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019711
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019711, RRID:AB_1852699
Product name
Anti-LANCL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019711
Antibody type
Polyclonal
Antigen
LanC-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSR
EERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQ
PAAKVDQETLTEMVKPSIDY
Storage
-20C
Provider Type Product Number
- No reagents -