HPA029535

LANCL2 antibody from Sigma-Aldrich
GPR69B, TASP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029535
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA029535, RRID:AB_10602342
Product name
Anti-LANCL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA029535
Antibody type
Polyclonal
Antigen
LanC lantibiotic synthetase component C-like 2 (bacterial) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCG
DAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSV
VCQESDLPDELLYGRAGY
Storage
-20C
Provider Type Product Number
- No reagents -