Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010574-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010574-M01, RRID:AB_437099
- Product name
- CCT7 monoclonal antibody (M01), clone 1D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CCT7.
- Antigen sequence
RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATN
ILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWE
PAMVRINALTAASEAACLIVSVDETIKNPRSTVD- Isotype
- IgG
- Antibody clone number
- 1D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
Freund A, Zhong FL, Venteicher AS, Meng Z, Veenstra TD, Frydman J, Artandi SE
Cell 2014 Dec 4;159(6):1389-403
Cell 2014 Dec 4;159(6):1389-403
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CCT7 monoclonal antibody (M01), clone 1D6 Western Blot analysis of CCT7 expression in HL-60 ( Cat # L014V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CCT7 expression in transfected 293T cell line by CCT7 monoclonal antibody (M01), clone 1D6.Lane 1: CCT7 transfected lysate(59.4 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in human pancreas.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CCT7 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol