Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010574-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010574-M02, RRID:AB_1112393
- Product name
- CCT7 monoclonal antibody (M02), clone 3A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CCT7.
- Antigen sequence
RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATN
ILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWE
PAMVRINALTAASEAACLIVSVDETIKNPRSTVD- Isotype
- IgG
- Antibody clone number
- 3A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Reconstitution of the human chaperonin CCT by co-expression of the eight distinct subunits in mammalian cells.
Machida K, Masutani M, Kobayashi T, Mikami S, Nishino Y, Miyazawa A, Imataka H
Protein expression and purification 2012 Mar;82(1):61-9
Protein expression and purification 2012 Mar;82(1):61-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CCT7 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol