Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503262 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CCT7 antibody: synthetic peptide directed towards the middle region of human CCT7
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQ
LLIGA YAKALEIIPR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
Guo D, Han J, Adam BL, Colburn NH, Wang MH, Dong Z, Eizirik DL, She JX, Wang CY
Biochemical and biophysical research communications 2005 Dec 2;337(4):1308-18
Biochemical and biophysical research communications 2005 Dec 2;337(4):1308-18
No comments: Submit comment
No validations: Submit validation data