HPA008425

CCT7 antibody from Sigma-Aldrich
Ccth, Nip7-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008425
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008425, RRID:AB_1078428
Product name
Anti-CCT7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008425
Antibody type
Polyclonal
Antigen
T-complex protein 1 subunit eta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLE
KIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRV
PEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFE
ETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEE
TE
Storage
-20C
Provider Type Product Number
- No reagents -