AMAb90541
antibody from Atlas Antibodies
Targeting: ATAD2
ANCCA, CT137, DKFZp667N1320, MGC29843, MGC5254, PRO2000
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90541 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90541, RRID:AB_2665580
- Product name
- Anti-ATAD2
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKY
APSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTP
VACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKD
DSQNAIDHK- Epitope
- Binds to an epitope located within the peptide sequence VGDKRSDPEQ as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0182
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references ATAD2 is highly expressed in ovarian carcinomas and indicates poor prognosis.
Wan WN, Zhang YX, Wang XM, Liu YJ, Zhang YQ, Que YH, Zhao WJ
Asian Pacific journal of cancer prevention : APJCP 2014;15(6):2777-83
Asian Pacific journal of cancer prevention : APJCP 2014;15(6):2777-83
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATAD2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: ATAD2 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415483) Lane 3: Negative control (vector only transfected HEK293T lysate)Lane 4: U-251
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-ATAD2 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of MCF7 cells using the Anti-ATAD2 monoclonal antibody, showing specific staining in nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and skeletal muscle tissues using AMAb90541 antibody. Corresponding ATAD2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in seminiferous tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no immunoreactivity in hepatocytes (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong nuclear positivity in a subset of glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows moderate to strong nuclear positivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.