Antibody data

Product number
H00005465-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005465-M03, RRID:AB_1136992
Product name
PPARA monoclonal antibody (M03), clone 1A8
Provider product page
Abnova Corporation - H00005465-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PPARA.
Antigen sequence
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQ
EISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITD
TLSPASSPSSVTYPVVPGSVDESPSGALNIECRIC
GDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCD
RSCKIQKKNRNKCQYCRFHKCLSVGRSHNAIRFGR
MPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRI
YEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSG
FSWQHGTSVVEDD
Isotype
IgG
Antibody clone number
1A8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -