Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP34068_P050 - Provider product page
- Provider
- Aviva Systems Biology
- Product name
- Ppara antibody - C-terminal region (ARP34068_P050)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- This is a rabbit polyclonal antibody against Ppara. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
- Reactivity
- Human, Rat
- Host
- Rabbit
- Antigen sequence
LHLQSNHPDDTFLFPKLLQKMVDLRQLVTEHAQLV
QVIKKTESDAALHPL- Vial size
- 50 µg
- Concentration
- 1 mg/ml
- Handling
- Add 50 µl of distilled water. Final anti-Ppara antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Submitted references Genetic ablation of solute carrier family 7a3a leads to hepatic steatosis in zebrafish during fasting.
Gu Q, Yang X, Lin L, Li S, Li Q, Zhong S, Peng J, Cui Z
Hepatology (Baltimore, Md.) 2014 Dec;60(6):1929-41
Hepatology (Baltimore, Md.) 2014 Dec;60(6):1929-41
No comments: Submit comment
Supportive validation
- Submitted by
- Aviva Systems Biology (provider)
- Main image
- Experimental details
- WB Suggested Anti-Ppara AntibodyTitration: 1.0µg/ml. Positive Control: Rat Brain