HPA026272

RBM6 antibody from Atlas Antibodies
3G2, DEF-3, DEF3, g16, NY-LU-12
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026272
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026272, RRID:AB_1847592
Product name
Anti-RBM6
Provider product page
Atlas Antibodies - HPA026272
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SQSPVQDQDKSQLSGREEQSSDAGLFKEEGGLDFL
GRQDTDYRSMEYRDVDHRLPGSQMFGYGQSKSFPE
GKTARDAQRD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -