HPA026272

antibody from Atlas Antibodies

Targeting: RBM6 3G2, DEF-3, DEF3, g16, NY-LU-12

Antibody data

Submit

Validation data

Product number: HPA026272 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA026272, RRID:AB_1847592
Product name: Anti-RBM6
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SQSPVQDQDKSQLSGREEQSSDAGLFKEEGGLDFL GRQDTDYRSMEYRDVDHRLPGSQMFGYGQSKSFPE GKTARDAQRD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RBM6 protein structure - HPA026272 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and lymph node using Anti-RBM6 antibody HPA026272 (A) shows similar protein distribution across tissues to independent antibody HPA027164 (B).
Antibody #2 product nr: HPA027164
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows distinct nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-RBM6 antibody HPA026272.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-RBM6 antibody HPA026272.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-RBM6 antibody HPA026272.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-RBM6 antibody HPA026272.
Sample type: HUMAN