HPA027164

RBM6 antibody from Sigma-Aldrich
3G2, DEF-3, DEF3, g16, NY-LU-12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027164
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027164, RRID:AB_1847593
Product name
Anti-RBM6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027164
Antibody type
Polyclonal
Antigen
RNA-binding protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEF
KDREMPPVDPNILDYIQPSTQDREHSGMNVNRREE
STHDHTIERPAFGIQKGEFEH
Storage
-20C
Provider Type Product Number
- No reagents -