Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501418 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNG1 antibody: synthetic peptide directed towards the N terminal of human KCNG1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAI
KGAFY RRAQRLRPQD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
Gutman GA, Chandy KG, Grissmer S, Lazdunski M, McKinnon D, Pardo LA, Robertson GA, Rudy B, Sanguinetti MC, Stühmer W, Wang X
Pharmacological reviews 2005 Dec;57(4):473-508
Pharmacological reviews 2005 Dec;57(4):473-508
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting