HPA004879

SCN7A antibody from Sigma-Aldrich
NaG, Nav2.1, Nav2.2, SCN6A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004879
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004879, RRID:AB_1079881
Product name
Anti-SCN7A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004879
Antibody type
Polyclonal
Antigen
Sodium channel protein type 7 subunit alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLKILCKTQNVPKDTMDHVNEVYVKEDISDHTLSE
LSNTQDFLKDKEKSSGTEKNATENESQSLIPSPSV
SETVPIASGESDIENLDNKEIQSKSGDGGSKEK
Storage
-20C
Provider Type Product Number
- No reagents -