Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011321-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011321-M01, RRID:AB_463949
- Product name
- XAB1 monoclonal antibody (M01), clone 3E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant XAB1.
- Antigen sequence
ELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHL
HAQGTPPYVINLDPAVHEVPFPANIDIRDTVKYKE
VMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQ
NMSKY- Isotype
- IgG
- Antibody clone number
- 3E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- XAB1 monoclonal antibody (M01), clone 3E1 Western Blot analysis of XAB1 expression in HL-60 ( Cat # L014V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of XAB1 expression in transfected 293T cell line by XAB1 monoclonal antibody (M01), clone 3E1.Lane 1: XAB1 transfected lysate(41.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged XAB1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to XAB1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to XAB1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol