HPA018823

CDPF1 antibody from Sigma-Aldrich
C22orf40, LOC150383
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018823
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018823, RRID:AB_1853018
Product name
Anti-C22orf40 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018823
Antibody type
Polyclonal
Antigen
UPF0595 protein C22orf40
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEE
SYVMKDPFTSDKDRFLVLGSCCSLCSRLVCVGPEC
SLFYSKRFCLPCVRENINAFPQEIRQDLEKRKAPS
K
Storage
-20C
Provider Type Product Number
- No reagents -