HPA018823

CDPF1 antibody from Atlas Antibodies
C22orf40, LOC150383
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018823
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018823, RRID:AB_1236285
Product name
Anti-CDPF1
Provider product page
Atlas Antibodies - HPA018823
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEE
SYVMKDPFTSDKDRFLVLGSCCSLCSRLVCVGPEC
SLFYSKRFCLPCVRENINAFPQEIRQDLEKRKAPS
K
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -