HPA004868

GALT antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004868
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004868, RRID:AB_1079130
Product name
Anti-GALT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004868
Antibody type
Polyclonal
Antigen
Galactose-1-phosphate uridylyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RANDHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEP
QLLKTVPRHDPLNPLCPGAIRANGEVNPQYDSTFL
FDNDFPALQPDAPSPGPSDHPLFQAKSARGVCKVM
CFHPWSD
Storage
-20C
Provider Type Product Number
- No reagents -