Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004869 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004869, RRID:AB_1080538
- Product name
- Anti-USP8
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTT
LRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCY
PQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESI
PSKPAAQTPPASIEVDENIELISGQNERMGPLNI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The genomic profiling and MAMLD1 expression in human and canines with Cushing’s disease
Deubiquitinase Usp8 regulates α-synuclein clearance and modifies its toxicity in Lewy body disease
Lack of Ubiquitin Specific Protease 8 (USP8) Mutations in Canine Corticotroph Pituitary Adenomas
Mutations in the deubiquitinase gene USP8 cause Cushing's disease
Wang A, Neill S, Newman S, Tryfonidou M, Ioachimescu A, Rossi M, Meij B, Oyesiku N
BMC Endocrine Disorders 2021;21(1)
BMC Endocrine Disorders 2021;21(1)
Deubiquitinase Usp8 regulates α-synuclein clearance and modifies its toxicity in Lewy body disease
Alexopoulou Z, Lang J, Perrett R, Elschami M, Hurry M, Kim H, Mazaraki D, Szabo A, Kessler B, Goldberg A, Ansorge O, Fulga T, Tofaris G
Proceedings of the National Academy of Sciences 2016;113(32)
Proceedings of the National Academy of Sciences 2016;113(32)
Lack of Ubiquitin Specific Protease 8 (USP8) Mutations in Canine Corticotroph Pituitary Adenomas
Thamm D, Sbiera S, Tryfonidou M, Weigand I, Grinwis G, Broeckx B, Herterich S, Allolio B, Deutschbein T, Fassnacht M, Meij B
PLOS ONE 2016;11(12):e0169009
PLOS ONE 2016;11(12):e0169009
Mutations in the deubiquitinase gene USP8 cause Cushing's disease
Reincke M, Sbiera S, Hayakawa A, Theodoropoulou M, Osswald A, Beuschlein F, Meitinger T, Mizuno-Yamasaki E, Kawaguchi K, Saeki Y, Tanaka K, Wieland T, Graf E, Saeger W, Ronchi C, Allolio B, Buchfelder M, Strom T, Fassnacht M, Komada M
Nature Genetics 2014;47(1):31-38
Nature Genetics 2014;47(1):31-38
No comments: Submit comment
No validations: Submit validation data