Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004869 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004869, RRID:AB_1080538
- Product name
- Anti-USP8
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTT
LRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCY
PQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESI
PSKPAAQTPPASIEVDENIELISGQNERMGPLNI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mutations in the deubiquitinase gene USP8 cause Cushing's disease
Reincke M, Sbiera S, Hayakawa A, Theodoropoulou M, Osswald A, Beuschlein F, Meitinger T, Mizuno-Yamasaki E, Kawaguchi K, Saeki Y, Tanaka K, Wieland T, Graf E, Saeger W, Ronchi C, Allolio B, Buchfelder M, Strom T, Fassnacht M, Komada M
Nature Genetics 2014 December;47(1):31-38
Nature Genetics 2014 December;47(1):31-38
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line A-549.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.