HPA004869

USP8 antibody from Sigma-Aldrich
HumORF8, KIAA0055, SPG59, UBPY
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004869
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004869, RRID:AB_1080538
Product name
Anti-USP8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004869
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTT
LRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCY
PQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESI
PSKPAAQTPPASIEVDENIELISGQNERMGPLNI
Storage
-20C
Provider Type Product Number
- No reagents -