HPA019734

FAM120A antibody from Sigma-Aldrich
C9orf10, DNAPTP1, KIAA0183, OSSA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019734
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019734, RRID:AB_1848369
Product name
Anti-FAM120A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019734
Antibody type
Polyclonal
Antigen
Constitutive coactivator of PPAR-gamma-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTK
AEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPT
RNHMDITTPPL
Storage
-20C
Provider Type Product Number
- No reagents -