Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008654-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008654-M01, RRID:AB_464136
- Product name
- PDE5A monoclonal antibody (M01), clone 9H5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PDE5A.
- Antigen sequence
SVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH
TIPVCKEGIRGHTESCSCPLQQSPRADNSVPGTPT
RKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQ
MPLTP- Isotype
- IgG
- Antibody clone number
- 9H5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Effects and mechanisms of action of sildenafil citrate in human chorionic arteries.
Maharaj CH, O'Toole D, Lynch T, Carney J, Jarman J, Higgins BD, Morrison JJ, Laffey JG
Reproductive biology and endocrinology : RB&E 2009 Apr 23;7:34
Reproductive biology and endocrinology : RB&E 2009 Apr 23;7:34
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PDE5A is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PDE5A on HeLa cell . [antibody concentration 20 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
