Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008654-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008654-A01, RRID:AB_461946
- Product name
- PDE5A polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PDE5A.
- Antigen sequence
SVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH
TIPVCKEGIRGHTESCSCPLQQSPRADNSVPGTPT
RKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQ
MPLTP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Chronic inflammation promotes myeloid-derived suppressor cell activation blocking antitumor immunity in transgenic mouse melanoma model.
Meyer C, Sevko A, Ramacher M, Bazhin AV, Falk CS, Osen W, Borrello I, Kato M, Schadendorf D, Baniyash M, Umansky V
Proceedings of the National Academy of Sciences of the United States of America 2011 Oct 11;108(41):17111-6
Proceedings of the National Academy of Sciences of the United States of America 2011 Oct 11;108(41):17111-6
No comments: Submit comment
No validations: Submit validation data