HPA020646

SETD1A antibody from Atlas Antibodies
KIAA0339, KMT2F, Set1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020646
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020646, RRID:AB_1856752
Product name
Anti-SETD1A
Provider product page
Atlas Antibodies - HPA020646
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AFGAFDQWWESKEEKAKPFQNAAKQQAKEEDKEKT
KLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGAL
RLPSFKVKRKEPSEISEASEEKRPRPSTPAEEDED
DP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -