Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA020646 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA020646, RRID:AB_1856752
- Product name
- Anti-SETD1A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AFGAFDQWWESKEEKAKPFQNAAKQQAKEEDKEKT
KLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGAL
RLPSFKVKRKEPSEISEASEEKRPRPSTPAEEDED
DP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Enhanced HSP70 lysine methylation promotes proliferation of cancer cells through activation of Aurora kinase B
Cho H, Shimazu T, Toyokawa G, Daigo Y, Maehara Y, Hayami S, Ito A, Masuda K, Ikawa N, Field H, Tsuchiya E, Ohnuma S, Ponder B, Yoshida M, Nakamura Y, Hamamoto R
Nature Communications 2012;3(1)
Nature Communications 2012;3(1)
No comments: Submit comment
No validations: Submit validation data