Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA020376 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA020376, RRID:AB_1855867
- Product name
- Anti-PSPH
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRR
AMGGAVPFKAALTERLALIQPSREQVQRLIAEQPP
HLTPGIRELVSRLQERNVQVFLISG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Functional genomics reveal that the serine synthesis pathway is essential in breast cancer
Possemato R, Marks K, Shaul Y, Pacold M, Kim D, Birsoy K, Sethumadhavan S, Woo H, Jang H, Jha A, Chen W, Barrett F, Stransky N, Tsun Z, Cowley G, Barretina J, Kalaany N, Hsu P, Ottina K, Chan A, Yuan B, Garraway L, Root D, Mino-Kenudson M, Brachtel E, Driggers E, Sabatini D
Nature 2011 August;476(7360):346-350
Nature 2011 August;476(7360):346-350
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines A-431 and HeLa using Anti-PSPH antibody. Corresponding PSPH RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line A-431.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong positivity in basal cells.
- Sample type
- HUMAN