Antibody data

Product number
H00005723-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005723-M01A, RRID:AB_1579289
Product name
PSPH monoclonal antibody (M01A), clone 3A5
Provider product page
Abnova Corporation - H00005723-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PSPH.
Antigen sequence
MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELA
KICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQ
PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQV
FLISGGFRSIVEHVASKLNIPATNVFANRLKFYFN
GEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKII
MIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAK
WYITDFVELLGELEE
Isotype
IgG
Antibody clone number
3A5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -