HPA019650

ANXA13 antibody from Sigma-Aldrich
ANX13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019650
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019650, RRID:AB_1844856
Product name
Anti-ANXA13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019650
Antibody type
Polyclonal
Antigen
Annexin A13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CTRTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNL
KKILVSLLQANRNEGDDVDKDLAGQDAKDLYDAGE
GRWGTDEL
Storage
-20C
Provider Type Product Number
- No reagents -