Antibody data
- Antibody Data
- Antigen structure
- References [14]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057167-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057167-M03, RRID:AB_566160
- Product name
- SALL4 monoclonal antibody (M03), clone 6E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SALL4.
- Antigen sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEIS
VIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGI
SADVEKPSATDGVPKHQFPHFLEENKIAVS- Isotype
- IgG
- Antibody clone number
- 6E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references NRG1 and KITL Signal Downstream of Retinoic Acid in the Germline to Support Soma-Free Syncytial Growth of Differentiating Spermatogonia.
Differential SALL4 immunoexpression in malignant rhabdoid tumours and epithelioid sarcomas.
Combination of hepatocellular markers is useful for prognostication in gastric hepatoid adenocarcinoma.
SALL4 immunohistochemistry in non-small-cell lung carcinomas.
The transcription factor SALL4 regulates stemness of EpCAM-positive hepatocellular carcinoma.
Metastatic seminomas in lymph nodes: CD10 immunoreactivity can be a pitfall of differential diagnosis.
Mediastinal seminoma: a case report with special emphasis on SALL4 as a new immunocytochemical marker.
α-Fetoprotein-producing ovarian tumor in a postmenopausal woman with germ cell differentiation.
α-Fetoprotein-producing gastric carcinoma and combined hepatocellular and cholangiocarcinoma show similar morphology but different histogenesis with respect to SALL4 expression.
Immunoexpression of SALL4 in Wilms tumors and developing kidney.
Specificity of brachyury in the distinction of chordoma from clear cell renal cell carcinoma and germ cell tumors: a study of 305 cases.
β-Catenin and K-RAS synergize to form primitive renal epithelial tumors with features of epithelial Wilms' tumors.
Expression pattern of stemness-related genes in human endometrial and endometriotic tissues.
Markers that define stemness in ESC are unable to identify the totipotent cells in human preimplantation embryos.
Chapman KM, Medrano GA, Chaudhary J, Hamra FK
Cell death discovery 2015;1
Cell death discovery 2015;1
Differential SALL4 immunoexpression in malignant rhabdoid tumours and epithelioid sarcomas.
Yoshida A, Asano N, Kawai A, Kawamoto H, Nakazawa A, Kishimoto H, Kushima R
Histopathology 2015 Jan;66(2):252-61
Histopathology 2015 Jan;66(2):252-61
Combination of hepatocellular markers is useful for prognostication in gastric hepatoid adenocarcinoma.
Osada M, Aishima S, Hirahashi M, Takizawa N, Takahashi S, Nakamura K, Tanaka M, Maehara Y, Takayanagi R, Oda Y
Human pathology 2014 Jun;45(6):1243-50
Human pathology 2014 Jun;45(6):1243-50
SALL4 immunohistochemistry in non-small-cell lung carcinomas.
Fujimoto M, Sumiyoshi S, Yoshizawa A, Sonobe M, Kobayashi M, Moriyoshi K, Kido A, Tanaka C, Koyanagi I, Date H, Haga H
Histopathology 2014 Jan;64(2):309-11
Histopathology 2014 Jan;64(2):309-11
The transcription factor SALL4 regulates stemness of EpCAM-positive hepatocellular carcinoma.
Zeng SS, Yamashita T, Kondo M, Nio K, Hayashi T, Hara Y, Nomura Y, Yoshida M, Hayashi T, Oishi N, Ikeda H, Honda M, Kaneko S
Journal of hepatology 2014 Jan;60(1):127-34
Journal of hepatology 2014 Jan;60(1):127-34
Metastatic seminomas in lymph nodes: CD10 immunoreactivity can be a pitfall of differential diagnosis.
Ota Y, Iihara K, Ryu T, Morikawa T, Fukayama M
International journal of clinical and experimental pathology 2013;6(3):498-502
International journal of clinical and experimental pathology 2013;6(3):498-502
Mediastinal seminoma: a case report with special emphasis on SALL4 as a new immunocytochemical marker.
Iwamoto N, Ishida M, Yoshida K, Kagotani A, Iwai M, Okabe H
Diagnostic cytopathology 2013 Sep;41(9):821-4
Diagnostic cytopathology 2013 Sep;41(9):821-4
α-Fetoprotein-producing ovarian tumor in a postmenopausal woman with germ cell differentiation.
Meguro S, Yasuda M
Annals of diagnostic pathology 2013 Feb;17(1):140-4
Annals of diagnostic pathology 2013 Feb;17(1):140-4
α-Fetoprotein-producing gastric carcinoma and combined hepatocellular and cholangiocarcinoma show similar morphology but different histogenesis with respect to SALL4 expression.
Ikeda H, Sato Y, Yoneda N, Harada K, Sasaki M, Kitamura S, Sudo Y, Ooi A, Nakanuma Y
Human pathology 2012 Nov;43(11):1955-63
Human pathology 2012 Nov;43(11):1955-63
Immunoexpression of SALL4 in Wilms tumors and developing kidney.
Deisch J, Raisanen J, Rakheja D
Pathology oncology research : POR 2011 Sep;17(3):639-44
Pathology oncology research : POR 2011 Sep;17(3):639-44
Specificity of brachyury in the distinction of chordoma from clear cell renal cell carcinoma and germ cell tumors: a study of 305 cases.
Sangoi AR, Karamchandani J, Lane B, Higgins JP, Rouse RV, Brooks JD, McKenney JK
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2011 Mar;24(3):425-9
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2011 Mar;24(3):425-9
β-Catenin and K-RAS synergize to form primitive renal epithelial tumors with features of epithelial Wilms' tumors.
Clark PE, Polosukhina D, Love H, Correa H, Coffin C, Perlman EJ, de Caestecker M, Moses HL, Zent R
The American journal of pathology 2011 Dec;179(6):3045-55
The American journal of pathology 2011 Dec;179(6):3045-55
Expression pattern of stemness-related genes in human endometrial and endometriotic tissues.
Forte A, Schettino MT, Finicelli M, Cipollaro M, Colacurci N, Cobellis L, Galderisi U
Molecular medicine (Cambridge, Mass.) 2009 Nov-Dec;15(11-12):392-401
Molecular medicine (Cambridge, Mass.) 2009 Nov-Dec;15(11-12):392-401
Markers that define stemness in ESC are unable to identify the totipotent cells in human preimplantation embryos.
Cauffman G, De Rycke M, Sermon K, Liebaers I, Van de Velde H
Human reproduction (Oxford, England) 2009 Jan;24(1):63-70
Human reproduction (Oxford, England) 2009 Jan;24(1):63-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SALL4 monoclonal antibody (M03), clone 6E3. Western Blot analysis of SALL4 expression in NIH/3T3(Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SALL4 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SALL4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol