HPA015291

SALL4 antibody from Sigma-Aldrich
dJ1112F19.1, ZNF797
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015291
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015291, RRID:AB_1856548
Product name
Anti-SALL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015291
Antibody type
Polyclonal
Antigen
Sal-like protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGG
VPTLPVSLGATSVVNNATVSKMDGSQSGISADVEK
PSATDGVPKHQFPHFLEENKIA
Storage
-20C
Provider Type Product Number
- No reagents -