HPA004479

AFG3L2 antibody from Sigma-Aldrich
SCA28, SPAX5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004479
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004479, RRID:AB_1078109
Product name
Anti-AFG3L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004479
Antibody type
Polyclonal
Antigen
AFG3-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTLLAKATAGEANVPFITVSGSEFLEMFVGVGPAR
VRDLFALARKNAPCILFIDEIDAVGRKRGRGNFGG
QSEQENTLNQLLVEMDGFNTTTNVVILAGTNRPDI
LDPALLRPGRFDRQIFIGPPDIKGRASIFKVHLRP
LK
Storage
-20C
Provider Type Product Number
- No reagents -