HPA004480

AFG3L2 antibody from Sigma-Aldrich
SCA28, SPAX5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004480
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004480, RRID:AB_1078108
Product name
Anti-AFG3L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004480
Antibody type
Polyclonal
Antigen
AFG3-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKLARKLASLTPGFSGADVANVCNEAALIAARHLS
DSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVA
YHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQ
YLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRI
TTGAQDD
Storage
-20C
Provider Type Product Number
- No reagents -