ABIN1109555
antibody from antibodies-online
Targeting: ZFP64
dJ548G19.1, dJ831D17.1, FLJ10734, FLJ12628, ZNF338
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109555 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 64 (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZFP64 antibody: synthetic peptide directed towards the N terminal of human ZFP64.
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
YLPTESNENQTATVISLPAKSRTKKPTTPPAQKRL
NCCYPGCQFKTAYGM- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references A human protein-protein interaction network: a resource for annotating the proteome.
Stelzl U, Worm U, Lalowski M, Haenig C, Brembeck FH, Goehler H, Stroedicke M, Zenkner M, Schoenherr A, Koeppen S, Timm J, Mintzlaff S, Abraham C, Bock N, Kietzmann S, Goedde A, Toksöz E, Droege A, Krobitsch S, Korn B, Birchmeier W, Lehrach H, Wanker EE
Cell 2005 Sep 23;122(6):957-68
Cell 2005 Sep 23;122(6):957-68
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Transfected 293T; WB Suggested Anti-ZFP64 Antibody Titration: 0.2-1 ug/ml. Positive Control: Transfected 293T; ZFP64 antibody - N-terminal region (AP42182PU-N) in Transfected 293T cells using Western Blot