HPA060521

CELSR1 antibody from Atlas Antibodies
ADGRC1, CDHF9, FMI2, HFMI2, ME2

Antibody data

Product number
HPA060521
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA060521, RRID:AB_2684303
Product name
Anti-CELSR1
Provider product page
Atlas Antibodies - HPA060521
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KHLKGVLGGRKLHLEDSATTRATLLTRSLNCNTTF
GDGPDMLRTDLGESTASLDSIVRDEGIQKLGVSSG
LVRGSHGEPDASLMPRSCKD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -